Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YCL067C  from Saccharomyces cerevisiae S288C
>YCL067C|YCL067C HMLALPHA2 SGDID:S000000572, Chr III from 13018-12386, Genome Release 64-1-1, reverse complement, Verified ORF, "Silenced copy of ALPHA2 at HML; homeobox-domain protein that associates with Mcm1p in haploid cells to repress a-specific gene expression and interacts with a1p in diploid cells to repress haploid-specific gene expression" ORGANISM: Saccharomyces cerevisiae S288C (210 aa)
MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR
ANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVT
QDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWV
SNRRRKEKTITIAPELADLLSGEPLAKKKE