Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YCL058W-A  from Saccharomyces cerevisiae S288C
>YCL058W-A|YCL058W-A ADF1 SGDID:S000028518, Chr III from 23584-23925, Genome Release 64-1-1, Verified ORF, "Transcriptional repressor encoded by the antisense strand of the FYV5 gene; negatively regulates transcription of FYV5 by binding to the promoter on the sense strand" ORGANISM: Saccharomyces cerevisiae S288C (113 aa)
MGKCSMKKKGVGKNVGVGKKVQKKRSISTAERKRTKLQVEKLNKSSETMIPTLLREASTQ
EPAKLKAETTLKAEELIKDQEKDSKVREQIRTEKSKTNDSMLKQIEMISGFSL