Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YCL058C  from Saccharomyces cerevisiae S288C
>YCL058C|YCL058C FYV5 SGDID:S000000563, Chr III from 23981-23523, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein involved in regulation of the mating pathway; binds with Matalpha2p to promoters of haploid-specific genes; required for survival upon exposure to K1 killer toxin; involved in ion homeostasis" ORGANISM: Saccharomyces cerevisiae S288C (152 aa)
MQYHSALYVYIYVTFTTIPYKEKPDIISICFSMLSFVFDFSVRICSRTLESFSWSLISSS
AFKVVSAFSLAGSCVLASRSSVGIIVSLLLFNFSTCNFVLFLSAVLIDLFFCTFLPTPTF
LPTPFFFMLHLPIFSLLNALELLYLIIAGLHI