Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YCL057C-A  from Saccharomyces cerevisiae S288C
>YCL057C-A|YCL057C-A YCL057C-A SGDID:S000007547, Chr III from 24325-24032, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies" ORGANISM: Saccharomyces cerevisiae S288C (97 aa)
MSEQAQTQQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF
KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV