Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YCL056C  from Saccharomyces cerevisiae S288C
>YCL056C|YCL056C PEX34 SGDID:S000000561, Chr III from 27359-26925, Genome Release 64-1-1, reverse complement, Verified ORF, "Peroxisomal integral membrane protein that regulates peroxisome populations; interacts with Pex11p, Pex25p, and Pex27p to control both constitutive peroxisome division and peroxisome morphology and abundance during peroxisome proliferation" ORGANISM: Saccharomyces cerevisiae S288C (144 aa)
MVSKKNTAEISAKDIWENIWSGVSSLLDFFAVLENLGVVNDKLYVSGLLRKVWLCYSCIS
VIKCVWKLIKLCKVKFKIDQRLDGEGNGLVKDKLINFKKKYNEHIRHITAALLQDLSYLM
VLIYPGTRLFKRLSNIITLCRIIV