Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YCL035C  from Saccharomyces cerevisiae S288C
>YCL035C|YCL035C GRX1 SGDID:S000000540, Chr III from 61173-60841, Genome Release 64-1-1, reverse complement, Verified ORF, "Hydroperoxide and superoxide-radical responsive heat-stable glutathione-dependent disulfide oxidoreductase with active site cysteine pair; protects cells from oxidative damage" ORGANISM: Saccharomyces cerevisiae S288C (110 aa)
MVSQETIKHVKDLIAENEIFVASKTYCPYCHAALNTLFEKLKVPRSKVLVLQLNDMKEGA
DIQAALYEINGQRTVPNIYINGKHIGGNDDLQELRETGELEELLEPILAN