Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YCL033C  from Saccharomyces cerevisiae S288C
>YCL033C|YCL033C MXR2 SGDID:S000000538, Chr III from 63282-62776, Genome Release 64-1-1, reverse complement, Verified ORF, "Methionine-R-sulfoxide reductase, involved in the response to oxidative stress; protects iron-sulfur clusters from oxidative inactivation along with MXR1; involved in the regulation of lifespan" ORGANISM: Saccharomyces cerevisiae S288C (168 aa)
MNKWSRLYVITVRRTFPGRRNIVLTQYWNKSKKMSDESNDVKWNDALTPLQLMVLRDKAT
ERPNTGAYLHTNESGVYHCANCDRPLYSSKAKFDARCGWPAFYEEVSPGAITYHRDNSLM
PARVEICCARCGGHLGHVFEGEGWKQLLNLPKDTRHCVNSASLNLKKD