Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YCL026C-A  from Saccharomyces cerevisiae S288C
>YCL026C-A|YCL026C-A FRM2 SGDID:S000000589, Chr III from 75285-74704, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein of unknown function, involved in the integration of lipid signaling pathways with cellular homeostasis; expression induced in cells treated with the mycotoxin patulin; has similarity to bacterial nitroreductases" ORGANISM: Saccharomyces cerevisiae S288C (193 aa)
MSPTGNYLNAITNRRTIYNLKPELPQGVGLDDVKRTVHVILKNTPTAFNSQVNRAVIIVG
DTHKRIWDAVASAMPTAEAKKRPESCRDEAYGSVIFFTDEGPTEKLQRDFPALAAAFPTC
AAHTTGAVQIQSWTALELLGLGANLQHYNDYVKSALPQDVPIAWTVQSQLVFGVPTALPE
EKTFINNVINVYH