Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YCL012C  from Saccharomyces cerevisiae S288C
>YCL012C|YCL012C YCL012C SGDID:S000029705, Chr III from 101633-101317,101788-101701, Genome Release 64-1-1, reverse complement, Verified ORF, "Putative protein of unknown function; orthologs are present in S. bayanus, S. paradoxus and Ashbya gossypii; YCL012C is not an essential gene" ORGANISM: Saccharomyces cerevisiae S288C (134 aa)
MKSLFYLKLLLWVVLLSLCLLMAHRKTKVADKFRALRSRIQLRFNRHIRLNDSFADDLEN
GLHSRNFDIISENSNDVRGGLDDVSKNEIKQIMENDNVDFDKARLLYMERKFGQNGIAPD
GTPIDPKAFTFDSR