Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YCL005W-A  from Saccharomyces cerevisiae S288C
>YCL005W-A|YCL005W-A VMA9 SGDID:S000028508, Chr III from 107023-107033,107111-107191,107288-107417, Genome Release 64-1-1, Verified ORF, "Vacuolar H+ ATPase subunit e of the V-ATPase V0 subcomplex; essential for vacuolar acidification; interacts with the V-ATPase assembly factor Vma21p in the ER; involved in V0 biogenesis" ORGANISM: Saccharomyces cerevisiae S288C (73 aa)
MSSFYTVVGVFIVVSAMSVLFWIMAPKNNQAVWRSTVILTLAMMFLMWAITFLCQLHPLV
APRRSDLRPEFAE