Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBR301W  from Saccharomyces cerevisiae S288C
>YBR301W|YBR301W PAU24 SGDID:S000000505, Chr II from 809057-809419, Genome Release 64-1-1, Verified ORF, "Cell wall mannoprotein with similarity to Tir1p, Tir2p, Tir3p, and Tir4p; member of the seripauperin multigene family encoded mainly in subtelomeric regions; expressed under anaerobic conditions, completely repressed during aerobic growth" ORGANISM: Saccharomyces cerevisiae S288C (120 aa)
MVKLTSIAAGVAAIAATASATTTLAQSDERVNLVELGVYVSDIRAHLAQYYSFQVAHPTE
TYPVEIAEAVFNYGDFTTMLTGIAPDQVTRMITGVPWYSSRLKPAISSALSKDGIYTIAN