Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YBR296C-A  from Saccharomyces cerevisiae S288C
>YBR296C-A|YBR296C-A YBR296C-A SGDID:S000028605, Chr II from 800242-800123, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching" ORGANISM: Saccharomyces cerevisiae S288C (39 aa)
MKVLDDWFSRKFSKAVHGNNHGTISLSTLSYIRVHKLVK