Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBR269C  from Saccharomyces cerevisiae S288C
>YBR269C|YBR269C FMP21 SGDID:S000000473, Chr II from 742576-742160, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies" ORGANISM: Saccharomyces cerevisiae S288C (138 aa)
MLCAIKSTGYRYPRTGALNLLRGRPFNMATRKITTERIPGPPKLPREEQEEFERLQRIAT
SQEAIDQYNAQATGDRTKESLNSPLLTKNDIGSFSPEFSKTIPEFEGDVNPKTGEVGGPK
QDPLRHGDYSFNGRVTDF