Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBR264C  from Saccharomyces cerevisiae S288C
>YBR264C|YBR264C YPT10 SGDID:S000000468, Chr II from 738369-737770, Genome Release 64-1-1, reverse complement, Verified ORF, "Rab family GTP-binding protein that contains the PEST signal sequence specific for proteolytic enzymes; may be involved in vesicular transport; overexpression leads to accumulation of Golgi-like cisternae with budding vesicles" ORGANISM: Saccharomyces cerevisiae S288C (199 aa)
MEATIKVVLLGDSSVGKTSIVTRLKSGKFLAKHAATIGAAFITKTIEVPSNDSSTEKRIH
MEIWDTAGQERYKSLVPMYYRDANIALIVFELGDVSSLQCAKTWFQDLQDRAQGTQVIIV
GNKYDLVCEEHSGEVTIPAELQGLPYVAVSAKTGYNFDTLNKIIISLVPESQFKTLSKNN
EQGNILEINKKKSGSGCIC