Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBR262C  from Saccharomyces cerevisiae S288C
>YBR262C|YBR262C AIM5 SGDID:S000000466, Chr II from 736040-735720, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein of unknown function; the authentic, non-tagged protein is detected in purified mitochondria in high-throughput studies; null mutant displays elevated frequency of mitochondrial genome loss" ORGANISM: Saccharomyces cerevisiae S288C (106 aa)
MSKLGPLARSVKWTLSVGVIGSVFYLYRYSNNGYFYDHDATWLKQDHQVQDLVDRKEVVP
GETRNRKLVVTDDGTAWSRTMGESIKDIWNEQIRNSVDWIYSWGKN