Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBR255C-A  from Saccharomyces cerevisiae S288C
>YBR255C-A|YBR255C-A YBR255C-A SGDID:S000007649, Chr II from 726917-726618,727074-727012, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; may interact with respiratory chain complexes III (ubiquinol-cytochrome c reductase) or IV (cytochrome c oxidase); identified by sequence comparison with hemiascomycetous yeast species" ORGANISM: Saccharomyces cerevisiae S288C (120 aa)
MGGNVLPIHYDPKTVKQLTKEITVASCIGAAQGALFSIASALLLRRFSSVYRNVRTQVRV
FYHCSWISMGAVFRADKQLLKFQTNYYREEQKRREKIMDEAAERGLFLEDESLNSSRSTT