Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBR252W  from Saccharomyces cerevisiae S288C
>YBR252W|YBR252W DUT1 SGDID:S000000456, Chr II from 722611-723054, Genome Release 64-1-1, Verified ORF, "deoxyuridine triphosphate diphosphatase (dUTPase); catalyzes hydrolysis of dUTP to dUMP and PPi, thereby preventing incorporation of uracil into DNA during replication; critical for the maintenance of genetic stability; also has diphosphatase activity on deoxyinosine triphosphate" ORGANISM: Saccharomyces cerevisiae S288C (147 aa)
MTATSDKVLKIQLRSASATVPTKGSATAAGYDIYASQDITIPAMGQGMVSTDISFTVPVG
TYGRIAPRSGLAVKNGIQTGAGVVDRDYTGEVKVVLFNHSQRDFAIKKGDRVAQLILEKI
VDDAQIVVVDSLEESARGAGGFGSTGN