Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBR233W-A  from Saccharomyces cerevisiae S288C
>YBR233W-A|YBR233W-A DAD3 SGDID:S000007595, Chr II from 684977-685261, Genome Release 64-1-1, Verified ORF, "Essential subunit of the Dam1 complex (aka DASH complex), couples kinetochores to the force produced by MT depolymerization thereby aiding in chromosome segregation; is transferred to the kinetochore prior to mitosis" ORGANISM: Saccharomyces cerevisiae S288C (94 aa)
MEHNLSPLQQEVLDKYKQLSLDLKALDETIKELNYSQHRQQHSQQETVSPDEILQEMRDI
EVKIGLVGTLLKGSVYSLILQRKQEQESLGSNSK