Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBR230C  from Saccharomyces cerevisiae S288C
>YBR230C|YBR230C OM14 SGDID:S000000434, Chr II from 679942-679549,680050-680040, Genome Release 64-1-1, reverse complement, Verified ORF, "Integral mitochondrial outer membrane protein; abundance is decreased in cells grown in glucose relative to other carbon sources; appears to contain 3 alpha-helical transmembrane segments; ORF encodes a 97-basepair intron" ORGANISM: Saccharomyces cerevisiae S288C (134 aa)
MSATAKHDSNASPNSDSEDGHHHNNKKECAIEYLKARLNSASAVACGYLQAFVSKTQDFA
KVCFLELQNPVVLVNLLLHSSVVCYLCNGYANHNARFLKGKPNSTVLATTAGALGLLTLD
GIISKKYYSRYDKK