Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YBR221W-A  from Saccharomyces cerevisiae S288C
>YBR221W-A|YBR221W-A YBR221W-A SGDID:S000028817, Chr II from 666538-666642, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; identified by expression profiling and mass spectrometry" ORGANISM: Saccharomyces cerevisiae S288C (34 aa)
MFSHFEVSENRPRKQPRRKRISLGMINTVVSLDR