Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YBR201C-A  from Saccharomyces cerevisiae S288C
>YBR201C-A|YBR201C-A YBR201C-A SGDID:S000087085, Chr II from 624696-624493, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function" ORGANISM: Saccharomyces cerevisiae S288C (67 aa)
MLAMKSFSQVSKSYKASAPSKKLTTLFYVAYITLGLTTPFLLPARMASKDTHYYKDEFCS
QRSYTRF