Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YBR200W-A  from Saccharomyces cerevisiae S288C
>YBR200W-A|YBR200W-A YBR200W-A SGDID:S000028535, Chr II from 622983-623147, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; identified by fungal homology and RT-PCR" ORGANISM: Saccharomyces cerevisiae S288C (54 aa)
MLLCFHMCQRIMWLPFDLMKWRRFHCGAVLVGTLSLRNRSPKILSLYFISDRTG