Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YBR196C-B  from Saccharomyces cerevisiae S288C
>YBR196C-B|YBR196C-B YBR196C-B SGDID:S000028816, Chr II from 614630-614526, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified by expression profiling and mass spectrometry" ORGANISM: Saccharomyces cerevisiae S288C (34 aa)
MWVVLSKEKILLKKAYYAKTILFSALVLRGVRGE