Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YBR196C-A  from Saccharomyces cerevisiae S288C
>YBR196C-A|YBR196C-A YBR196C-A SGDID:S000028534, Chr II from 614173-614024, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified by fungal homology and RT-PCR" ORGANISM: Saccharomyces cerevisiae S288C (49 aa)
MSRVYIYPLTVFYFFAIEMSVFCYYNWFYRRNFPYLFRPIFPFLIVLIS