Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBR194W  from Saccharomyces cerevisiae S288C
>YBR194W|YBR194W AIM4 SGDID:S000000398, Chr II from 610038-610409, Genome Release 64-1-1, Verified ORF, "Protein proposed to be associated with the nuclear pore complex; null mutant is viable, displays elevated frequency of mitochondrial genome loss and is sensitive to freeze-thaw stress" ORGANISM: Saccharomyces cerevisiae S288C (123 aa)
MDQKKDPSNNLTERRVSKVQRPNKKKVRNQVESLSRNLERNKEGQLLQTVSKGHLEADSG
HSLGREKENGELGIRSIFYDKDWNPRGTAPSHYRNIPYNPATFKRRTEVQARLGNLENIK
IPK