Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBR188C  from Saccharomyces cerevisiae S288C
>YBR188C|YBR188C NTC20 SGDID:S000000392, Chr II from 604107-603685, Genome Release 64-1-1, reverse complement, Verified ORF, "Member of the NineTeen Complex (NTC) that contains Prp19p and stabilizes U6 snRNA in catalytic forms of the spliceosome containing U2, U5, and U6 snRNAs" ORGANISM: Saccharomyces cerevisiae S288C (140 aa)
MPSLRDLSLERDQELNQLRARINQLGKTGKEEANDFVGLNISNEPVYDTVIQTGQSSNAT
NSFVQETIQKTKQKESGQPYIIPQKNEHQRYIDKVCETSDLKAKLAPIMEVLEKKTNEKI
KGIIRKRVLQEPDRDNDDSG