Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YBR182C-A  from Saccharomyces cerevisiae S288C
>YBR182C-A|YBR182C-A YBR182C-A SGDID:S000028603, Chr II from 595555-595361, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching" ORGANISM: Saccharomyces cerevisiae S288C (64 aa)
MKIFTLYTMIQQYFFDNGGVYSIKNFYSAVPKEKMNIILVSLDCELQKLALKLSKKTSGT
HTTH