Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBR173C  from Saccharomyces cerevisiae S288C
>YBR173C|YBR173C UMP1 SGDID:S000000377, Chr II from 582172-581726, Genome Release 64-1-1, reverse complement, Verified ORF, "Short-lived chaperone required for correct maturation of the 20S proteasome; may inhibit premature dimerization of proteasome half-mers; degraded by proteasome upon completion of its assembly" ORGANISM: Saccharomyces cerevisiae S288C (148 aa)
MNIVPQDTFKSQVSTDQDKSVLSSAVPSLPDTLRQQEGGAVPLSTQLNDRHPLESTLKNW
ETTQRQRQMEQYRQIFGIAEPMKRTMEMEIVNRTDFNPLSTNGSIHRDILLNKECSIDWE
DVYPGTGLQASTMVGDDVHSKIEKQLGI