Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YBR162W-A  from Saccharomyces cerevisiae S288C
>YBR162W-A|YBR162W-A YSY6 SGDID:S000002158, Chr II from 565231-565428, Genome Release 64-1-1, Verified ORF, "Protein whose expression suppresses a secretory pathway mutation in E. coli; has similarity to the mammalian RAMP4 protein involved in secretion" ORGANISM: Saccharomyces cerevisiae S288C (65 aa)
MAVQTPRQRLANAKFNKNNEKYRKYGKKKEGKTEKTAPVISKTWLGILLFLLVGGGVLQL
ISYIL