Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBR135W  from Saccharomyces cerevisiae S288C
>YBR135W|YBR135W CKS1 SGDID:S000000339, Chr II from 504854-505306, Genome Release 64-1-1, Verified ORF, "Cyclin-dependent protein kinase regulatory subunit and adaptor; modulates proteolysis of M-phase targets through interactions with the proteasome; role in transcriptional regulation, recruiting proteasomal subunits to target gene promoters" ORGANISM: Saccharomyces cerevisiae S288C (150 aa)
MYHHYHAFQGRKLTDQERARVLEFQDSIHYSPRYSDDNYEYRHVMLPKAMLKVIPSDYFN
SEVGTLRILTEDEWRGLGITQSLGWEHYECHAPEPHILLFKRPLNYEAELRAATAAAQQQ
QQQQQQQQQQQQQHQTQSISNDMQVPPQIS