Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBR122C  from Saccharomyces cerevisiae S288C
>YBR122C|YBR122C MRPL36 SGDID:S000000326, Chr II from 484503-483970, Genome Release 64-1-1, reverse complement, Verified ORF, "Mitochondrial ribosomal protein of the large subunit; overproduction suppresses mutations in the COX2 leader peptide-encoding region" ORGANISM: Saccharomyces cerevisiae S288C (177 aa)
MLKSIFAKRFASTGSYPGSTRITLPRRPAKKIQLGKSRPAIYHQFNVKMELSDGSVVIRR
SQYPKGEIRLIQDQRNNPLWNPSRDDLVVVDANSGGSLDRFNKRYSSLFSVDSTTPNSSS
ETVELSEENKKKTQIKKEEKEDVSEKAFGMDDYLSLLDDSEQQIKSGKLASKKRDKK