>YBR120C|YBR120C CBP6 SGDID:S000000324, Chr II from 480923-480435, Genome Release 64-1-1, reverse complement, Verified ORF, "Mitochondrial protein required for translation of the COB mRNA; forms a complex with Cbp3p that binds to mt ribosomes near the polypeptide tunnel exit and promotes efficient translation of the COB mRNA; Cbp3p-Cbp6p complex also interacts with newly synthesized cytochrome b (Cobp) and Cbp4p to promote assembly of Cobp into the cytochrome bc1 complex" ORGANISM: Saccharomyces cerevisiae S288C (162 aa)
MSSSQVVRDSAKKLVNLLEKYPKDRIHHLVSFRDVQIARFRRVAGLPNVDDKGKSIKEKK
PSLDEIKSIINRTSGPLGLNKEMLTKIQNKMVDEKFTEESINEQIRALSTIMNNKFRNYY
DIGDKLYKPAGNPQYYQRLINAVDGKKKESLFTAMRTVLFGK