Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBR111W-A  from Saccharomyces cerevisiae S288C
>YBR111W-A|YBR111W-A SUS1 SGDID:S000028510, Chr II from 462139-462209,462290-462429,462500-462579, Genome Release 64-1-1, Verified ORF, "Component of both the SAGA histone acetylase and TREX-2 complexes; interacts with RNA polymerase II; involved in mRNA export coupled transcription activation and elongation; involved in post-transcriptional tethering of active genes to the nuclear periphery and to non-nascent mRNP" ORGANISM: Saccharomyces cerevisiae S288C (96 aa)
MTMDTAQLKSQIQQYLVESGNYELISNELKARLLQEGWVDKVKDLTKSEMNINESTNFTQ
ILSTVEPKALEMVSDSTRETVLKQIREFLEEIVDTQ