Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBR109C  from Saccharomyces cerevisiae S288C
>YBR109C|YBR109C CMD1 SGDID:S000000313, Chr II from 458362-457919, Genome Release 64-1-1, reverse complement, Verified ORF, "Calmodulin; Ca++ binding protein that regulates Ca++ independent processes (mitosis, bud growth, actin organization, endocytosis, etc.) and Ca++ dependent processes (stress-activated pathways), targets include Nuf1p, Myo2p and calcineurin" ORGANISM: Saccharomyces cerevisiae S288C (147 aa)
MSSNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSPSEAEVNDLMNEIDVDG
NHQIEFSEFLALMSRQLKSNDSEQELLEAFKVFDKNGDGLISAAELKHVLTSIGEKLTDA
EVDDMLREVSDGSGEINIQQFAALLSK