Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBR091C  from Saccharomyces cerevisiae S288C
>YBR091C|YBR091C TIM12 SGDID:S000000295, Chr II from 427484-427155, Genome Release 64-1-1, reverse complement, Verified ORF, "Essential protein of the inner mitochondrial membrane, peripherally localized; component of the TIM22 complex, which is a twin-pore translocase that mediates insertion of numerous multispanning inner membrane proteins" ORGANISM: Saccharomyces cerevisiae S288C (109 aa)
MSFFLNSLRGNQEVSQEKLDVAGVQFDAMCSTFNNILSTCLEKCIPHEGFGEPDLTKGEQ
CCIDRCVAKMHYSNRLIGGFVQTRGFGPENQLRHYSRFVAKEIADDSKK