Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBR090C  from Saccharomyces cerevisiae S288C
>YBR090C|YBR090C YBR090C SGDID:S000000294, Chr II from 426516-426333,427058-426874, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm and nucleus" ORGANISM: Saccharomyces cerevisiae S288C (122 aa)
MVPAPGSRAFPSPVFLGGVFFVFFFRWRGNYKVQQVRLRQYWEFTLWETAPNTKQKNDFF
AKTLTYIKLALWPQLKKQSNQRNQRRGPPGERRILTPLRGACQLICSLLMKTETLSVPRI
LT