Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBR089C-A  from Saccharomyces cerevisiae S288C
>YBR089C-A|YBR089C-A NHP6B SGDID:S000002157, Chr II from 426489-426190, Genome Release 64-1-1, reverse complement, Verified ORF, "High-mobility group (HMG) protein that binds to and remodels nucleosomes; involved in recruiting FACT and other chromatin remodelling complexes to the chromosomes; functionally redundant with Nhp6Ap; homologous to mammalian HMGB1 and HMGB2" ORGANISM: Saccharomyces cerevisiae S288C (99 aa)
MAATKEAKQPKEPKKRTTRRKKDPNAPKRGLSAYMFFANENRDIVRSENPDVTFGQVGRI
LGERWKALTAEEKQPYESKAQADKKRYESEKELYNATRA