Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBR085C-A  from Saccharomyces cerevisiae S288C
>YBR085C-A|YBR085C-A YBR085C-A SGDID:S000007522, Chr II from 419164-418907, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm and to the nucleus" ORGANISM: Saccharomyces cerevisiae S288C (85 aa)
MSSALYKQSTNFTHSTGSFLQSAPVELTTVSGYQEFLKKQEKKNYEIQTVLSEDKSHGYV
LKDGEVIANIIGEAKDYLLDLAGQA