Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBR082C  from Saccharomyces cerevisiae S288C
>YBR082C|YBR082C UBC4 SGDID:S000000286, Chr II from 407027-406628,407169-407123, Genome Release 64-1-1, reverse complement, Verified ORF, "Ubiquitin-conjugating enzyme (E2), mediates degradation of abnormal or excess proteins, including calmodulin and histone H3; interacts with many SCF ubiquitin protein ligases; component of the cellular stress response" ORGANISM: Saccharomyces cerevisiae S288C (148 aa)
MSSSKRIAKELSDLERDPPTSCSAGPVGDDLYHWQASIMGPADSPYAGGVFFLSIHFPTD
YPFKPPKISFTTKIYHPNINANGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPL
VPEIAHIYKTDRPKYEATAREWTKKYAV