Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBR077C  from Saccharomyces cerevisiae S288C
>YBR077C|YBR077C SLM4 SGDID:S000000281, Chr II from 392293-391805, Genome Release 64-1-1, reverse complement, Verified ORF, "Component of the EGO complex, which is involved in the regulation of microautophagy, and of the GSE complex, which is required for proper sorting of amino acid permease Gap1p; gene exhibits synthetic genetic interaction with MSS4" ORGANISM: Saccharomyces cerevisiae S288C (162 aa)
MVMLHSKNVKGFLENTLKPYDLHSVDFKTSSLQSSMIITATNGGILSYATSNNDVPKNSI
NEINSVNNLKMMSLLIKDKWSEDENDTEEQHSNSCYPVEIDSFKTKIYTYEMEDLHTCVA
QIPNSDLLLLFIAEGSFPYGLLVIKIERAMRELTDLFGYKLG