Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YBR072C-A  from Saccharomyces cerevisiae S288C
>YBR072C-A|YBR072C-A YBR072C-A SGDID:S000028532, Chr II from 383021-382860, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified by fungal homology and RT-PCR" ORGANISM: Saccharomyces cerevisiae S288C (53 aa)
MHILTRSSKNAFPRSRSRQDIHISSHIHRDTSNSALLKILVITRTRLDSFVKT