Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBR062C  from Saccharomyces cerevisiae S288C
>YBR062C|YBR062C YBR062C SGDID:S000000266, Chr II from 366502-365976,366600-366585, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Protein of unknown function that interacts with Msb2p; may play a role in activation of the filamentous growth pathway." ORGANISM: Saccharomyces cerevisiae S288C (180 aa)
MSTYEEEHGIQQNSRDYQEVGGTSQEEQRRQVRSQLQGLFQNFGNTSGEGDAHSDSTLLL
RLLSQMLPESLQEEWLQEMDKGKSAGCPDTFAASLPRINKKKLKATDNCSICYTNYLEDE
YPLVVELPHCHHKFDLECLSVWLSRSTTCPLCRDNVMGHRIINEIDTTEAELEEDWGMYG