Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YBR058C-A  from Saccharomyces cerevisiae S288C
>YBR058C-A|YBR058C-A TSC3 SGDID:S000007521, Chr II from 356566-356324, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein that stimulates the activity of serine palmitoyltransferase (Lcb1p, Lcb2p) several-fold; involved in sphingolipid biosynthesis" ORGANISM: Saccharomyces cerevisiae S288C (80 aa)
MTQHKSSMVYIPTTKEAKRRNGKSEGILNTIEEVVEKLYWTYYIHLPFYLMASFDSFFLH
VFFLTIFSLSFFGILKYCFL