Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBR047W  from Saccharomyces cerevisiae S288C
>YBR047W|YBR047W FMP23 SGDID:S000000251, Chr II from 331833-332360, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; proposed to be involved in iron or copper homeostasis; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies" ORGANISM: Saccharomyces cerevisiae S288C (175 aa)
MLINHLSKIRTVRHFSNIKPVLSKEVSRRVIVAPASHFKTSSPNVKSNIPIHEYKQLPED
SNYIEKHYKELQVFLNEFLIKKLNKTYADFEGDPDELVFQLEKFIELEVTPRYTNHSAPD
GCEERFKSIGDRIVVDRYLDFVKDVRLTLLLNGGHSFIFDVMLQAKEVFDKMQKE