Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBR016W  from Saccharomyces cerevisiae S288C
>YBR016W|YBR016W YBR016W SGDID:S000000220, Chr II from 270247-270633, Genome Release 64-1-1, Verified ORF, "Tail-anchored plasma membrane protein containing a conserved CYSTM module; predicted to be palmitoylated; has similarity to hydrophilins, which are involved in the adaptive response to hyperosmotic conditions" ORGANISM: Saccharomyces cerevisiae S288C (128 aa)
MSANDYYGGTAGEKSQYSRPSNPPPSSAHQNKTQERGYPPQQQQQYYQQQQQHPGYYNQQ
GYNQQGYNQQGYNQQGYNQQGYNQQGYNQQGHQQPVYVQQQPPQRGNEGCLAACLAALCI
CCTMDMLF