Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBR014C  from Saccharomyces cerevisiae S288C
>YBR014C|YBR014C GRX7 SGDID:S000000218, Chr II from 267336-266725, Genome Release 64-1-1, reverse complement, Verified ORF, "Cis-golgi localized monothiol glutaredoxin; more similar in activity to dithiol than other monothiol glutaredoxins; involved in the oxidative stress response; does not bind metal ions; functional overlap with GRX6" ORGANISM: Saccharomyces cerevisiae S288C (203 aa)
MAIVINKRNVRVLVITNLLLIVVFFVLRNSNASVNESITTHHPDSLVTFDNSGNAPGTHQ
SVHDTVNTQDKEAEEVDKNSGDAEFDAAAEYNKIMEQSPMIVFSKTGCPYSKKLKALLTN
SYTFSPSYYVVELDRHEHTKELQDQIEKVTGRRTVPNVIIGGTSRGGYTEIAELHKNDEL
LDSFKKWSDGAFTVKANSQSESA