Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBR013C  from Saccharomyces cerevisiae S288C
>YBR013C|YBR013C YBR013C SGDID:S000000217, Chr II from 265881-265492, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function, haploid deletion mutant exhibits synthetic phenotype with alpha-synuclein" ORGANISM: Saccharomyces cerevisiae S288C (129 aa)
MIYPLFRICILGAFLLGSYACLENSTQKGIEGVTLSHNSVQINNTLAKSAPFCESDALSM
NYSTENMLSNNACDYTKNSSYPYIITIITKAFDNALENSLNLQANRKLYHRVGTCIQNIF
YQLLLTVNY