Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBR009C  from Saccharomyces cerevisiae S288C
>YBR009C|YBR009C HHF1 SGDID:S000000213, Chr II from 255684-255373, Genome Release 64-1-1, reverse complement, Verified ORF, "Histone H4, core histone protein required for chromatin assembly and chromosome function; one of two identical histone proteins (see also HHF2); contributes to telomeric silencing; N-terminal domain involved in maintaining genomic integrity" ORGANISM: Saccharomyces cerevisiae S288C (103 aa)
MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLK
SFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG