Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YBR005W  from Saccharomyces cerevisiae S288C
>YBR005W|YBR005W RCR1 SGDID:S000000209, Chr II from 245906-246547, Genome Release 64-1-1, Verified ORF, "Protein of the ER membrane involved in cell wall chitin deposition; may function in the endosomal-vacuolar trafficking pathway, helping determine whether plasma membrane proteins are degraded or routed to the plasma membrane" ORGANISM: Saccharomyces cerevisiae S288C (213 aa)
MGLISYENEAINEVKKADNHHVSKFVTSYYGPSSSSWQSGIWILFVLFVAAVILIILFTF
VANRRRRRMGRAPIRGTAWLTPPSYRQSQQQYTGTVQQRTDDYVPEYTETANEHDLGYYD
QRGEFHPNDKAAYVAPPPLVQECSSESVNSLERPPAAVVHQANSLDTDYGLTRPSNGRVP
AVSDTVEQLERLPGGTTTQEINPPERAKVNARS