Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YBL108C-A  from Saccharomyces cerevisiae S288C
>YBL108C-A|YBL108C-A PAU9 SGDID:S000007592, Chr II from 7733-7605, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein of unknown function, member of the seripauperin multigene family encoded mainly in subtelomeric regions" ORGANISM: Saccharomyces cerevisiae S288C (42 aa)
MLTGIAPDQVTRMITGVPWYSSRLKPAISSALSKDGIYTIAN